CP-1C

Long-Acting Amylin Analog

Strength: 5 mg · 10 mg

Pack Size: Single vial · 5-vial pack · 10-vial kit

Product specifications and published batch reports are available to browse. Verify your email, complete your research profile, and sign the laboratory-use attestation to access pricing and protected researcher features.

Verify researcher access →

Brief Description

Long-acting amylin analog studied in metabolic pathway research alongside incretin receptor signaling. The 5mg and 10mg strengths have separate batch documentation. Review the report for the applicable strength and lot. For research use only - not for human consumption.

Testing Archive

Review current and previous batch records, including COAs and supporting third-party testing documentation.

Browse Testing Archive →

Compound Specifications

CAS 1415456-99-3

MW 4409 g/mol

Formula C194H312N54O59S2

Sequence XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP

Storage & Handling

Consult the material’s current documentation and your laboratory’s approved procedures for receipt and storage.

For laboratory research use only — not for human consumption

Need a different size? Let us know →